Rapsyn Antibody

  • Contact Vendor

Target RAPSN
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym 43 kDa postsynaptic protein, Acetylcholine receptor-associated 43 kDa protein, CMS1D43 kDa receptor-associated protein of the synapse, CMS1EMGC3597, RAPsyn, rapsyn, receptor-associated protein of the synapse, receptor-associated protein of the synapse, 43kD, RNF205RING finger protein 205
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CMS1D, CMS1E, MGC3597, RNF205
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARKALDKALDAIE