RECQL5 Antibody

  • Contact Vendor

Target RECQL5
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym DNA helicase, RecQ-like type 5, EC 3.6.4.12, EC 3.6.1, FLJ90603, RecQ protein-like 5ATP-dependent DNA helicase Q5, RecQ5, RECQ5RecQ protein 5
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ90603, RECQ5
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AIAKYFGDALPACAKGCDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGDFSRYDEGSGGSGDEGRDEAHKREWN