RECQ1 Antibody

  • Contact Vendor

Target RECQL
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym DNA helicase, RecQ-like type 1, DNA-dependent ATPase Q1, EC 3.6.4.12, EC 3.6.1, RecQ protein-like (DNA helicase Q1-like), RecQ protein-like 1, RECQ1, RecQ1ATP-dependent DNA helicase Q1, RecQL1, RECQL1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases RECQL1, RecQ1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HVLTDAQKILCIEKCFTFTASFNRPNLYYEVRQKPSNTEDFIEDIVKLINGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDK