TMBIM1 Antibody

  • Contact Vendor

Target TMBIM1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym LFG3, MST100, PP1201, Protein RECS1 homolog, RECS1MSTP100, transmembrane BAX inhibitor motif containing 1, transmembrane BAX inhibitor motif-containing protein 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases LFG3, MST100, MSTP100, RECS1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHT