DDIT4 Antibody

  • Contact Vendor

Target Ddit4
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym Dig2, DNA-damage-inducible transcript 4, FLJ20500, HIF-1 responsive RTP801 (RTP801), Protein regulated in development and DNA damage response 1, REDD-1DNA damage-inducible transcript 4 protein, REDD1HIF-1 responsive protein RTP801, RTP801RP11-442H21.1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases Dig2, FLJ20500, REDD-1, REDD1, RP11-442H21.1, RTP801
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QLLQESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALD