REEP1 Antibody

  • Contact Vendor

Target Reep1
Species Cross Reactivity Rattus norvegicus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym C2ORF23, C2orf23, chromosome 2 open reading frame 23, receptor accessory protein 1, receptor expression-enhancing protein 1, SPG31FLJ13110
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases C2orf23, FLJ13110, SPG31
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to REEP1(receptor accessory protein 1) The peptide sequence was selected from the C terminal of REEP1. Peptide sequence ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA