REEP4 Antibody

  • Contact Vendor

Target Reep4
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym C8orf20chromosome 8 open reading frame 20, FLJ22246, FLJ22277, PP432, receptor accessory protein 4, receptor expression enhancing protein 4, receptor expression-enhancing protein 4
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases C8orf20, FLJ22246, FLJ22277
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to REEP4(receptor accessory protein 4) The peptide sequence was selected from the N terminal of REEP4. Peptide sequence EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE