TFPI2 Antibody

  • Contact Vendor

Target TFPI2
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications EIA, WB
Target Species Homo sapiens
Target/Molecule Synonym Placental protein 5, PP5FLJ21164, TFPI-2REF1, tissue factor pathway inhibitor 2
Unit 0.5 mg
Format Protein G purified
Concentration 1.0 mg/ml
NCBI Gene Aliases FLJ21164,PP5,REF1,TFPI-
Company Novus Biologicals
Immunogen Recombinant Human TFPI-2 domain 1 produced in non-transgenic plants.SEQ.IMMUNOGEN: HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV Purity: >98%.
Gene Name tissue factor pathway inhibitor 2