TFPI2 Antibody

  • Contact Vendor

Target TFPI2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IF
Target Species Homo sapiens
Target/Molecule Synonym Placental protein 5, PP5FLJ21164, tissue factor pathway inhibitor 2, TFPI-2REF1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FLJ21164, PP5, REF1, TFPI-2
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to TFPI2(tissue factor pathway inhibitor 2) The peptide sequence was selected from the middle region of TFPI2. Peptide sequence NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT