REG1B Antibody

  • Contact Vendor

Target REG1B
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym lithostathine-1-beta, Pancreatic stone protein 2, pancreatic threadprotein), PSPS2PSP-2, REGLREG-1-beta, regenerating islet-derived 1 beta, Regenerating islet-derived protein 1-beta, Regenerating protein I beta, REGH, secretory pancreatic stone protein 2
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases PSPS2, REGH, REGI-BETA, REGL
Cite This Product Novus Biologicals cat# NBP1-80037 RRID:AB_11030111
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the N terminal of human REG1B (NP_006498). Peptide sequence MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYF