Reg3a Antibody

  • Contact Vendor

Target REG3A
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym hepatocarcinoma-intestine-pancreas, HIPpancreatitis-associated protein, Human proislet peptide, pancreatic beta cell growth factor, PAPPAP-H, PBCGF, Pancreatitis-associated protein 1, PAP homologous protein, PAP1FLJ18565, proliferation-inducing protein 34, proliferation-inducing protein 42, Reg III-alpha, REG3, REG-3-alpha, regenerating islet-derived 3 alpha, regenerating islet-derived protein 3-alpha, Regenerating islet-derived protein III-alpha, REG-III
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FLJ18565, HIP, PAP, PAP-H, PAP1, PBCGF, REG-III, REG3
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to REG3A (regenerating islet-derived 3 alpha) The peptide sequence was selected from the N terminal of REG3A. Peptide sequence GSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLV