P15RS Antibody

  • Contact Vendor

Target RPRD1A
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym Cyclin-dependent kinase inhibitor 2B-related protein, Cyclin-dependent kinase inhibitor 2B-related protein (p15INK4B-related protein), FLJ10656, HsT3101, MGC19513, p15INK4B-related protein, P15RScyclin-dependent kinase 2B-inhibitor-related protein, regulation of nuclear pre-mRNA domain containing 1A, regulation of nuclear pre-mRNA domain-containing protein 1A
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ10656, HsT3101, MGC19513, P15RS
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTL