RPRD1B Antibody

  • Contact Vendor

Target RPRD1B
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym Cell cycle-related and expression-elevated protein in tumor, cell-cycle related and expression-elevated protein in tumor, chromosome 20 open reading frame 77, CREPTC20orf77, dJ1057B20.2, DKFZp434P0735, FLJ44520, NET60, regulation of nuclear pre-mRNA domain containing 1B, regulation of nuclear pre-mRNA domain-containing protein 1B
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases C20orf77, CREPT, DKFZp434P0735, FLJ44520, NET60, dJ1057B20.2
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPRD1B (regulation of nuclear pre-mRNA domain containing 1B) The peptide sequence was selected from the middle region of RPRD1B. Peptide sequence KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAAS