RCC1 Antibody

  • Contact Vendor

Target Rcc1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym Cell cycle regulatory protein, CHC1RCC1-I, chromosome condensation 1, Chromosome condensation protein 1, guanine nucleotide-releasing protein, regulator of chromosome condensation, regulator of chromosome condensation 1, SNHG3-RCC1, SNHG3-RCC1 readthrough transcript
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CHC1, RCC1-I, SNHG3-RCC1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVM