RCBTB2 Antibody

  • Contact Vendor

Target Rcbtb2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym CHC1-L, CHC1LRCC1-like G exchanging factor RLG, Chromosome condensation 1-like, regulator of chromosome condensation (RCC1) and BTB (POZ) domain containingprotein 2, RCC1 and BTB domain-containing protein 2, RCC1-like G exchanging factor, regulator of chromosome condensation and BTB domain containing protein 2, Regulator of chromosome condensation and BTB domain-containing protein 2, RLG
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CHC1L
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SLCSEEELQLIRQACVFGSAGNEVLYTTVNDEIFVLGTNCCGCLGLGDVQSTIEPRRLDSLNGKKIACLSYG