Raptor Antibody

  • Contact Vendor

Target RPTOR
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym KIAA1303p150 target of rapamycin (TOR)-scaffold protein containing WD-repeats, KOG1, Mip1, p150 target of rapamycin (TOR)-scaffold protein, Raptor, RAPTOR, raptor, regulatory-associated protein of mTOR, regulatory associated protein of MTOR, complex 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases KIAA1303, KOG1, Mip1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DHSTTIDHNVAMMLAQLVSDGSPMVRKELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSPCTPRLRSVSSYGNIRAVATARSLNKSLQNLSL