RSC1A1 Antibody

  • Contact Vendor

Target RSC1A1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym hRS1, regulatory solute carrier protein family 1 member 1, regulatory solute carrier protein, family 1, member 1, RS1Transporter regulator RS1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases RS1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KLTGTSSDTGREAVENVNFRSLGDGLSTDKEGVPKSRESINKNRSVTVTSAKTSNQLHCTLGVEISPKLLAGEEDALNQTSEQTKSLSSNF