PKA regulatory subunit I beta Antibody

  • PKA regulatory subunit I beta Antibody

    CatalogueID : NBP1-87451

  • Contact Vendor

Target Prkar1b
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym cAMP-dependent protein kinase type I-beta regulatory subunit, PRKAR1, protein kinase, cAMP-dependent, regulatory, type I, beta
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases PRKAR1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSNSQSDSHDEEVSPT