RELL1 Antibody

  • Contact Vendor

Target Rell1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym FLJ21778, PSEC0162, RELT-like 1, RELT-like protein 1, tmp_locus_29
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ21778, MGC50583
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NEANADVLKAMVADNSLYDPESPVTPSTPGSPPVSPGPLSPGGTPGKHVCGHHLHTVGGVVERDVCHRCRHKRWHFIKPTNKSRESRPRRQGEVTVLSVGRFRVTKVEHKSNQKERRSLMSVSGAETVNGE