REM1 Antibody

  • Contact Vendor

Target REM1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym GESGD:REM, GTPase-regulating endothelial cell sprouting, GTP-binding protein REM 1, GTPase GES, MGC48669, Rad and Gem-like GTP-binding protein 1, REM, RAS (RAD and GEM)-like GTP-binding, RAS (RAD and GEM)-like GTP-binding 1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases GD:REM, GES, MGC48669, REM
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to REM1(RAS (RAD and GEM)-like GTP-binding 1) Antibody(against the N terminal of REM1. Peptide sequence SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT