RSG1 Antibody

  • Contact Vendor

Target RSG1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym C1orf89, chromosome 1 open reading frame 89, MGC10731, miro domain-containing protein C1orf89, Rem/Rab-Similar GTPase 1, REM2 and RAB-like small GTPase 1, RP4-733M16.4
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases C1orf89, MGC10731, RP4-733M16.4
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KFDQYMHTDVPERDLTAFRQAWELPLLRVKSVPGRRLADGRTLDGRAGLADVAHILNGLAEQLWHQDQVAAGLLPNPPESAPE