RSF1 Antibody

  • Contact Vendor

Target RSF1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym HBV pX associated protein-8, hepatitis B virus x associated protein, Hepatitis B virus X-associated protein, HBXAPp325 subunit of RSF chromatin-remodeling complex, p325, remodeling and spacing factor 1, RSF-1, Rsf-1, XAP8HBV pX-associated protein 8
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases HBXAP, RSF-1, XAP8, p325
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RSF1(remodeling and spacing factor 1) The peptide sequence was selected from the middle region of RSF1. Peptide sequence QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK