Renin Antibody

  • Contact Vendor

Target REn
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym angiotensin-forming enzyme, Angiotensinogenase, angiotensinogenase, EC 3.4.23, EC 3.4.23.15, FLJ10761, HNFJ2, renin, renin precursor, renal
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases FLJ10761, HNFJ2
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to REN(renin) The peptide sequence was selected from the C terminal of REN. Peptide sequence YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA