Renin Antibody

  • Contact Vendor

Target REn
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym angiotensin-forming enzyme, Angiotensinogenase, angiotensinogenase, EC 3.4.23, EC 3.4.23.15, FLJ10761, HNFJ2, renin, renin precursor, renal
Unit 0.1 ml
Format Immunogen affinity purified
Concentration 0.2 mg/ml
NCBI Gene Aliases FLJ10761, HNFJ2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFD
Isotype IgG