PRCC Antibody

  • Contact Vendor

Target PRCC
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym MGC17178, papillary renal cell carcinoma (translocation-associated), Papillary renal cell carcinoma translocation-associated gene protein, proline-rich protein PRCC, RCCP1MGC4723, TPRC
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MGC17178, MGC4723, RCCP1, TPRC
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PDEAEPEPEEEEAVAPTSGPALGGLFASLPAPKGPALLPPPPQMLAPAFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGVGEGLGLGLPS