RENBP Antibody

  • Contact Vendor

Target Renbp
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym AGE, EC 5.1.3.8, GlcNAc 2-epimerase, N-acylglucosamine 2-epimerase, N-acetyl-D-glucosamine 2-epimerase, RBP, renin binding protein, Renin-binding protein, RnBP, RNBP
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases RBP, RNBP
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RILQHVQRDGQAVLENVSEGGKELPGCLGRQQNPGHTLEAGWFLLRHCIRKGDPELRAHVIDKFLLLPFHSGWDPDHGGLFYFQDADNFCPTQLEWAMKLWWPHSEAMIA