REST Antibody

  • Contact Vendor

Target REST
Species Cross Reactivity Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym Neural-restrictive silencer factor, NRSFneuron restrictive silencer factor, RE1-silencing transcription factor, XBRrepressor binding to the X2 box, X2 box repressor
Unit 0.05 mg
Format Peptide affinity purified
Concentration Lyoph
NCBI Gene Aliases NRSF, XBR
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide towards Rest. Peptide sequence ANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGE