RCOR2 Antibody

  • Contact Vendor

Target rcor2
Species Cross Reactivity Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym REST corepressor 2
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to the C terminal of Rcor2. Immunizing peptide sequence PPEANTKFNSRWTTDEQLLAVQAIRRYGKDFGAIAEVIGNKTLTQVKTFF