CoREST3/RCOR3 Antibody

  • Contact Vendor

Target Rcor3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym FLJ10876, FLJ16298, KIAA1343, REST corepressor 3, RP11-318L16.1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ10876, FLJ16298, RP11-318L16.1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RSRTSLMDRQARKLANRHNQGDSDDDVEETHPMDGNDSDYDPKKEAKKEGNTEQPVQTSKIGLGRREYQSLQHRHHSQRSKCRPPKGMYLTQEDVVAVSCSPNAANT