CHX10 Antibody

  • Contact Vendor

Target vsx2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym ceh-10 homeo domain containing homolog, ceh-10 homeo domain containing homolog (C. elegans), ceh-10 homeodomain containing homolog (C. elegans), Ceh-10 homeodomain-containing homolog, CHX10MCOPCB3, Homeobox protein CHX10, HOX10C elegans ceh-10 homeo domain-containing homolog, MCOP2, RET1, visual system homeobox 2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CHX10, HOX10, MCOP2, MCOPCB3, RET1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAH
Isotype IgG