Ret Antibody

  • Contact Vendor

Target Ret
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym CDHR16, CDHF12MTC1, EC 2.7.10, Hirschsprung disease 1, Hirschsprung disease), MEN2A, MEN2B, multiple endocrine neoplasia and medullary thyroid carcinoma 1, ret proto-oncogene, RET transforming sequence
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CDHF12, CDHR16, HSCR1, MEN2A, MEN2B, MTC1, PTC, RET-ELE1, RET51
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM