GUCY2F Antibody

  • Contact Vendor

Target Gucy2f
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym CYGF, EC 4.6.1, GC-FEC 4.6.1.2, guanylate cyclase 2F, retinalRETGC-2, Guanylate cyclase F, GUC2DL, GUC2Fguanylate cyclase 2D-like, membrane (retina-specific), RETGC2, retinal guanylyl cyclase 2, ROS-GC2RetGC-2, Rod outer segment membrane guanylate cyclase 2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CYGF, GC-F, GUC2DL, GUC2F, RETGC-2, ROS-GC2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWELHSTYTVDMEMELLR