RCN1 Antibody

  • Contact Vendor

Target RCN1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym FLJ37041, FLJ55835, PIG20, proliferation-inducing gene 20, reticulocalbin 1, EF-hand calcium binding domain, reticulocalbin-1, Rcal, RCAL, RCN
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ37041, FLJ55835, PIG20, RCAL, RCN
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQA