RTN1 Antibody

  • Contact Vendor

Target rtn1
Species Cross Reactivity Mus musculus
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target/Molecule Synonym Neuroendocrine-specific proteinNSPMGC133250, reticulon-1, reticulon 1
Unit 50 ug
Format Peptide affinity purified
Concentration LYOPH mg/ml
NCBI Gene Aliases MGC133250,NS
Company Novus Biologicals
Immunogen Synthetic peptides corresponding to RTN1(reticulon 1) The peptide sequence was selected from the N terminal of RTN1. Peptide sequence EEREAELDSELIIESCDASSASEESPKREQDSPPMKPSALDAIREETGVR.
Gene Name reticulon 1