Reticulon 2 Antibody

  • Contact Vendor

Target RTN2
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym Neuroendocrine-specific protein-like 1, Neuroendocrine-specific protein-like I, NSP-like protein I, NSP2, NSPL1NSP-like protein 1, NSPLI, reticulon 2, reticulon-2
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases NSP2, NSPL1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RTN2(reticulon 2) The peptide sequence was selected from the N terminal of RTN2. Peptide sequence MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE