Nogo Antibody

  • Contact Vendor

Target RTN4
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym ASY, foocen, Foocen, Human NogoA, KIAA0886, My043 protein, Nbla00271, Nbla10545, Neuroendocrine-specific protein, Neuroendocrine-specific protein C homolog, Neurite outgrowth inhibitor, neurite growth inhibitor 220, Nogo protein, NOGO-A, Nogo-B, NOGOC, Nogo-C, NOGORTN4-B1, NSP, NSP-CL, NI220/250, reticulon 4, reticulon 5, reticulon-4, Reticulon-5, reticulon-5, RTN4-A, RTN4-B2, RTN4-C, RTN-X, RTN-x
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases ASY, NI220/250, NOGO, NOGO-A, NOGOC, NSP, NSP-CL, Nbla00271, Nbla10545, Nogo-B, Nogo-C, RTN-X, RTN4-A, RTN4-B1, RTN4-B2, RTN4-C
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RTN4(reticulon 4) The peptide sequence was selected from the middle region of RTN4. Peptide sequence FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI