RTN4RL1 Antibody

  • Contact Vendor

Target Rtn4rl1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym DKFZp547J144, nogo receptor-like 2, Nogo-66 receptor homolog 2, Nogo-66 receptor-related protein 3, NgR3, NGRH2, NGRL2, reticulon 4 receptor-like 1, reticulon-4 receptor-like 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp547J144, NGRH2, NgR3
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AVPCVSPGLRHGQDLKLLRAEDFRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFD