RTN3 Antibody

  • Contact Vendor

Target rtn3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym ASYIPASY interacting protein, HAP, isoforme III, isoforme VI, Neuroendocrine-specific protein-like 2, Neuroendocrine-specific protein-like II, NSPL2NSP-like protein II, NSPLIIhomolog of ASY protein, NSP-like protein 2, reticulon 3, reticulon-3, RTN3-A1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases ASYIP, HAP, NSPL2, NSPLII, RTN3-A1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILAKEGKDHLDLLDMKKMEKPQGTSNNVSDSSVSLAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQIDKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEY