RD3 Antibody

  • Contact Vendor

Target RD3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym LCA12C1orf36chromosome 1 open reading frame 36, protein RD3, retinal degeneration 3
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases C1orf36, LCA12
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RD3(retinal degeneration 3) The peptide sequence was selected from the N terminal of RD3. Peptide sequence GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV