ROM1 Antibody

  • Contact Vendor

Target ROM1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym retinal outer segment membrane protein 1, ROSP1tspan-23, rod outer segment membrane protein 1, ROM, RP7, Tetraspanin-23, Tspan-23, TSPAN23tetraspanin-23
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases ROM, ROSP1, RP7, TSPAN23
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to ROM1(retinal outer segment membrane protein 1) The peptide sequence was selected from the middle region of ROM1. Peptide sequence NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT