RP2 Antibody

  • Contact Vendor

Target RP2
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym DELXp11.3, KIAA0215, NME10, protein XRP2, retinitis pigmentosa 2 (X-linked recessive), TBCCD2, XRP2
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases DELXp11.3, KIAA0215, NME10, TBCCD2, XRP2
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RP2(retinitis pigmentosa 2 (X-linked recessive)) The peptide sequence was selected from the middle region of RP2. Peptide sequence LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG