RP9 Antibody

  • Contact Vendor

Target RP9
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym PAP-1Pim-1-associated protein, Pim-1 kinase associated protein, retinitis pigmentosa 9 (autosomal dominant), retinitis pigmentosa 9 protein
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases PAP-1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PEQELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGLIKEDETKPEDCIPDVPGNEHAREFLAHAPTKGLWM