p130 Antibody

  • Contact Vendor

Target RBL2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym FLJ26459, p130, P130, pRb2, PRB2, RBR-2, Rb2, RB2, retinoblastoma-like 2 (p130), retinoblastoma-like protein 2,130 kDa retinoblastoma-associated protein, Retinoblastoma-related protein 2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ26459, P130, Rb2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IAGSPLTPRRVTEVRADTGGLGRSITSPTTLYDRYSSPPASTTRRRLFVENDSPSDGGTPGRMPPQPLVNAVPVQNVSGETVSVTPVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQV