RAI1 Antibody

  • Contact Vendor

Target rai1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym KIAA1820DKFZP434A139, MGC12824, retinoic acid-induced protein 1, retinoic acid induced 1, Smith-Magenis syndrome chromosome region, SMCR, SMSDKFZp434A139
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp434A139, KIAA1820, MGC12824, SMCR, SMS
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SKPPFSLENHSACLDSVAKSAWPRPGEPEALPDSLQLDKGGNAKDFSPGLFEDPSVAFATPDPKKTTGPLSFGTKPTLGVPAPDPTTAAFDCFPDTTAASS