RAI14 Antibody

  • Contact Vendor

Target RAI14
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym retinoic acid induced 14
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp564G013, KIAA1334, NORPEG, RAI13
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ISPTQLSDVSSPRSITSTPLSGKESVFFAEPPFKAEISSIRENKDRLSDSTTGADSLLDISSEADQQDLLSLLQAKVASLTLHNKELQDK