RAI14 Antibody

  • Contact Vendor

Target RAI14
Species Cross Reactivity Sus scrofa, Rattus norvegicus, Mus musculus, Gallus gallus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym retinoic acid induced 14
Unit 0.05 mg
Format Peptide affinity purified
Concentration Lyoph
NCBI Gene Aliases DKFZp564G013, KIAA1334, NORPEG, RAI13
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the middle region of human RAI14. Peptide sequence LSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAED