RARB Antibody

  • Contact Vendor

Target Rarb
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym beta polypeptide, HBV-activated protein, retinoic acid receptor, beta
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases HAP, NR1B2, RRB2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGV