RARRES1 Antibody

  • Contact Vendor

Target RARRES1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym RAR-responsive protein TIG1, retinoic acid receptor responder (tazarotene induced) 1, retinoic acid receptor responder protein 1, TIG1Tazarotene-induced gene 1 protein
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases TIG1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIW