Retinoid X Receptor gamma Antibody

  • Contact Vendor

Target rxrg
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym NR2B3retinoid X receptor-gamma, Nuclear receptor subfamily 2 group B member 3, Retinoid X receptor gamma, retinoid X receptor, gamma, retinoic acid receptor RXR-gamma, RXRC
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases NR2B3, RXRC
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RXRG(retinoid X receptor, gamma) The peptide sequence was selected from the N terminal of RXRG. Peptide sequence NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH