Retinoid X Receptor beta Antibody

  • Contact Vendor

Target RXRB
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym DAUDI6, H-2RIIBP, MHC class I promoter binding protein, NR2B2MGC1831, Nuclear receptor subfamily 2 group B member 2, RCoR-1, Retinoid X receptor beta, retinoid X receptor, beta, retinoic acid receptor RXR-beta
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases DAUDI6, H-2RIIBP, MGC1831, NR2B2, RCoR-1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RXRB(retinoid X receptor, beta) The peptide sequence was selected from the N terminal of RXRB. Peptide sequence PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA